PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g21100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 113aa    MW: 12370.4 Da    PI: 10.438
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g21100genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.52.1e-191145135
       GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
               Cs C+tt Tp+WR gp+g+k+LCnaCG+++rk+++
  Tp2g21100 11 CSDCKTTMTPMWRGGPSGPKSLCNACGIRFRKQRR 45
               ********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.62E-13446No hitNo description
PROSITE profilePS5011412.387541IPR000679Zinc finger, GATA-type
SMARTSM004012.4E-18561IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.1E-16945IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS0034401136IPR000679Zinc finger, GATA-type
PfamPF003202.5E-171145IPR000679Zinc finger, GATA-type
CDDcd002023.74E-111145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0048527Biological Processlateral root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 113 aa     Download sequence    Send to blast
MEEDKKTIRC CSDCKTTMTP MWRGGPSGPK SLCNACGIRF RKQRRSELLG IRIIHSHKAY  60
KKINPSVSST SSPSPSSLSS SHGGVALKKR RSLKEEEQAA LCLLLLSCSS VFA
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4469892e-32DQ446989.1 Arabidopsis thaliana clone pENTR221-At5g26930 zinc finger family protein (At5g26930) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597259.15e-57PREDICTED: GATA transcription factor 23-like
SwissprotQ8LC591e-43GAT23_ARATH; GATA transcription factor 23
TrEMBLA0A078CZT69e-57A0A078CZT6_BRANA; BnaC07g28410D protein
STRINGBra036600.1-P3e-46(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144841622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.19e-42GATA transcription factor 23